The domain within your query sequence starts at position 3 and ends at position 118; the E-value for the DUF872 domain shown below is 1.7e-22.

PSRTNLATGLPSSKVKYSRLASTDDGYIDLQFKKSPPKIPYKAIALATVLFLIGTFLIII
GSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDF

DUF872

DUF872
PFAM accession number:PF05915
Interpro abstract (IPR008590): This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF872