The domain within your query sequence starts at position 309 and ends at position 472; the E-value for the DUF89 domain shown below is 1.9e-30.

CFEEALDGVVKRAVASQPESMDAVERAEKFRQKYWGKLQTLRHQPFAYGTLTVRSLLDTR
EHCLNEFNFPDPYSKVKQKENGLALKCFQSVTRSLDSLGWEERQLALVKGLLAGNVFDWG
AKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYTKWLQRLKITV

DUF89

DUF89
PFAM accession number:PF01937
Interpro abstract (IPR002791):

This domain is found in putative carboxyl methyltransferase Armt1, uncharacterized budding yeast protein YMR027W (PDB code: 3PT1), At2g17340 from Arabidopsis thaliana, and it is also found at the C-terminal portion of eukaryotic pantothenate kinases [(PUBMED:16511115), (PUBMED:25732820)]. Despite the characterization of Armt1 as a carboxyl methyltransferase, a second study suggests that these proteins are hydrolases whose function is to limit potentially harmful buildups of phosphometabolites [(PUBMED:27322068)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF89