The domain within your query sequence starts at position 89 and ends at position 370; the E-value for the DUF908 domain shown below is 1.8e-74.

LKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYI
TRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLQMLKYPPSATTLHFEFYADPGA
EVKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPKDKQMLLFTHIRLAHGFS
NHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASL
RTLTSIVHLERTPKLSSIIDCTGTASYHGFLPVLVRNCIQAM

DUF908

DUF908
PFAM accession number:PF06012
Interpro abstract (IPR010309):

This is a domain of unknown function found at the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing. This domain is found in association with and immediately N-terminal to another domain of unknown function: IPR010314.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF908