The domain within your query sequence starts at position 1 and ends at position 132; the E-value for the DUF913 domain shown below is 1.4e-33.
LLEEICNLGRDPKYICQKPSIQKADGTATAPPPRSNHAAEEASSEDEEEEEVQAMQSFNS AQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHCQEFVNQKGLLPLV TILGLPNLPIDF
DUF913 |
---|
PFAM accession number: | PF06025 |
---|---|
Interpro abstract (IPR010314): | This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing. This domain is found in association with and immediately C-terminal to another domain of unknown function: IPR010309 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF913