The domain within your query sequence starts at position 429 and ends at position 815; the E-value for the DUF913 domain shown below is 1.2e-126.

VTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPSTTQEG
EEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISNAE
YYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVF
SALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLGSAVDELMR
HQPTLKTDATTAIIKLLEEICNLGRDPKYICQKPSIQKADGTATAPPPRSNHAAEEASSE
DEEEEEVQAMQSFNSAQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDD
HCQEFVNQKGLLPLVTILGLPNLPIDF

DUF913

DUF913
PFAM accession number:PF06025
Interpro abstract (IPR010314):

This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing. This domain is found in association with and immediately C-terminal to another domain of unknown function: IPR010309.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF913