The domain within your query sequence starts at position 59 and ends at position 323; the E-value for the DUF92 domain shown below is 3.9e-76.
VVPVVIACNGFKKKSLDHSGALGGLVVGFILTIANFSFFTSLMTFFLSSSKLTKWRGNIK KQLDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEMPIDFSKQHTASWMCLSLLA ALASSAGDTWASEVAPVLSKSSPRLITTWEKVPVGTNGGVTAVGLASSLLGGTFVGLAYF LTQLVFVNDLDISAPQWPIIAFGGVAGLFGSLVDSFLGATMQFSGLDERTGLVVSSPTQE TKHIAGKPILDNNAVNLFSSVLVAL
DUF92 |
---|
PFAM accession number: | PF01940 |
---|---|
Interpro abstract (IPR002794): | Many members of this family have no known function and are predicted to be integral membrane proteins. One member of the family has been characterised as protein PGR (AtPGR). PGR is suggested to be a potential glucose-responsive regulator in carbohydrate metabolism in plants. This entry also includes protein VTE6, which is a Pphytyl-phosphate kinase catalyzing the conversion of phytyl-monophosphate to phytyl-diphosphate [ (PUBMED:26452599) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF92