The domain within your query sequence starts at position 8 and ends at position 122; the E-value for the DUF953 domain shown below is 7.4e-55.

SVLGFEEFDKAVKEHEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFI
YCQVGDKPYWKDPNNDFRQKLKITAVPTLLKYGTPQKLVESECCQSSLVEMIFSE

DUF953

DUF953
PFAM accession number:PF06110
Interpro abstract (IPR010357):

This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF953