The domain within your query sequence starts at position 8 and ends at position 122; the E-value for the DUF953 domain shown below is 7.4e-55.
SVLGFEEFDKAVKEHEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFI YCQVGDKPYWKDPNNDFRQKLKITAVPTLLKYGTPQKLVESECCQSSLVEMIFSE
DUF953 |
 |
|---|
| PFAM accession number: | PF06110 |
|---|---|
| Interpro abstract (IPR010357): | This domain can be found in thioredoxin domain-containing protein 17 (also known as TRP14) [ (PUBMED:14607843) ] and 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF953