The domain within your query sequence starts at position 39 and ends at position 206; the E-value for the Dapper domain shown below is 4.1e-83.
ERQEATLAGLAELGYLRQRQELLVRGALRCSGTVGTVAPRSGELRGDAAQRSRLEEKFLE ENILLLRRQLNCLRRRDAGLLNQLQELDKQISDLRLDVEKTSEEHLETDSRPSSGFYELS DGASGSLSNSSNSVFSECLSSCHSSTCFCSPLEAALTISDGCPKSADV
Dapper |
---|
PFAM accession number: | PF15268 |
---|---|
Interpro abstract (IPR024843): | Dact (dapper) proteins were identified through binding to dishevelled, a cytoplasmic protein central to Wnt signaling. The different dact proteins seem to have distinct signaling and developmental roles. In Zebrafish, dact1 but not dact2 is required to enhance Wnt/beta-catenin activity, while functional interaction with Wnt/Ca2+-PCP signaling has been described for dact2, but not dact1 [ (PUBMED:15539487) ]. Data from other vertebrates seems to be consistent with a distinct signaling and developmental role for dact1, dact2 and dact3 [ (PUBMED:16881060) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dapper