The domain within your query sequence starts at position 1 and ends at position 702; the E-value for the Daxx domain shown below is 1.5e-297.

MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSSNSG
SRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNILSRVLA
RSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLTNTENT
ASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEARLKRKLIR
LFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDYGDVLRAVE
KAATRHSLGLPRQQLQLLAQDAFRDVGVRLQERRHLDLIYNFGCHLTDDYRPGVDPALSD
PTLARRLRENRTLAMNRLDEVISKYAMMQDKTEEGERQKRRARLLGTAPQPSDPPKASSE
SGEGPSGMASQECPTTSKAETDDDDDDDDDDDDEDNEENNEGNESPTSPSDFFHRRNSEP
AEGLRTPEGQQKRGLTETPASPPGASLDPPSTDAESSGEQLLEPLLGDESPVSQLAELEM
EALPEERDISSSRKKSEDSLPTILENGAAVVTSTSVNGRVSSHTWRDASPPSKRFRKEKK
QLGSGLLGNSYIKEPMAQQDSGQNTSVQPMPSPPLASVASVADSSTRVDSPSHELVTSSL
CSPSPSLLLQTPQAQSLRQCIYKTSVATQCDPEEIIVLSDSD

Daxx

Daxx
PFAM accession number:PF03344
Interpro abstract (IPR031333):

The Daxx protein (also known as death domain-associated protein 6) is thought to play a role in apoptosis. Daxx forms a complex with Axin [(PUBMED:11225842)]. Daxx is a scaffold protein shown to play diverse roles in transcription and cell cycle regulation. This N-terminal domain folds into a left-handed four-helix bundle (H1, H2, H4, H5) that binds to the N-terminal residues of the tumour-suppressor Rassf1C [(PUBMED:21134643)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Daxx