SMART: Pfam domain Daxx

The domain within your query sequence starts at position 54 and ends at position 152; the E-value for the Daxx domain shown below is 1.3e-51.

GGSSNSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCN
ILSRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLA

Daxx

PFAM accession number:	PF03344
Interpro abstract (IPR031333):	The Daxx protein (also known as death domain-associated protein 6) is thought to play a role in apoptosis. Daxx forms a complex with Axin [ (PUBMED:11225842) ]. Daxx is a scaffold protein shown to play diverse roles in transcription and cell cycle regulation. This N-terminal domain folds into a left-handed four-helix bundle (H1, H2, H4, H5) that binds to the N-terminal residues of the tumour-suppressor Rassf1C [ (PUBMED:21134643) ].

PFAM accession number:

PF03344

Interpro abstract (IPR031333):

The Daxx protein (also known as death domain-associated protein 6) is thought to play a role in apoptosis. Daxx forms a complex with Axin [ (PUBMED:11225842) ]. Daxx is a scaffold protein shown to play diverse roles in transcription and cell cycle regulation. This N-terminal domain folds into a left-handed four-helix bundle (H1, H2, H4, H5) that binds to the N-terminal residues of the tumour-suppressor Rassf1C [ (PUBMED:21134643) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Daxx