The domain within your query sequence starts at position 620 and ends at position 707; the E-value for the Dicer_dimer domain shown below is 1.4e-25.

AIGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMDSVRL
AERVVALICCEKLHKIGELDEHLMPVGK

Dicer_dimer

Dicer_dimer
PFAM accession number:PF03368
Interpro abstract (IPR005034):

This domain is found in members of the Dicer protein family which function in RNA interference, an evolutionarily conserved mechanism for gene silencing using double-stranded RNA (dsRNA) molecules. It is essential for the activity of Dicer [(PUBMED:16424907), (PUBMED:17666393)]. It is a divergent double stranded RNA-binding domain [(PUBMED:16954143)]. The N-terminal alpha helix of this domain is in a different orientation to that found in canonical dsRNA-binding domains. This results in a change of charge distribution at the potential dsRNA-binding surface and in the N- and C-termini of the domain being in close proximity [(PUBMED:20106953)]. This domain has weak dsRNA-binding activity. It mediates heterodimerisation of Dicer proteins with their respective protein partners [(PUBMED:20106953)].

GO function:endoribonuclease activity, producing 5'-phosphomonoesters (GO:0016891)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dicer_dimer