The domain within your query sequence starts at position 77 and ends at position 128; the E-value for the Dickkopf_N domain shown below is 6.4e-20.
PCSSDKECEVGRYCHSPHQGSSACMLCRRKKKRCHRDGMCCPGTRCNNGICI
Dickkopf_N |
---|
PFAM accession number: | PF04706 |
---|---|
Interpro abstract (IPR006796): | Dickkopf proteins are a class of Wnt antagonists. They possess two conserved cysteine-rich regions. This entry represents the N-terminal conserved region [ (PUBMED:12167704) ]. The C-terminal region has been found to share significant sequence similarity to the colipase fold ( IPR001981 ) [ (PUBMED:9663378) ]. |
GO process: | multicellular organism development (GO:0007275), negative regulation of Wnt signaling pathway (GO:0030178) |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dickkopf_N