The domain within your query sequence starts at position 85 and ends at position 142; the E-value for the Dickkopf_N domain shown below is 3.5e-21.

PCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICM

Dickkopf_N

Dickkopf_N
PFAM accession number:PF04706
Interpro abstract (IPR006796): Dickkopf proteins are a class of Wnt antagonists. They possess two conserved cysteine-rich regions. This entry represents the N-terminal conserved region [(PUBMED:12167704)]. The C-terminal region has been found to share significant sequence similarity to the colipase fold (IPR001981) [(PUBMED:9663378)].
GO process:negative regulation of Wnt signaling pathway (GO:0030178), multicellular organism development (GO:0007275)
GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dickkopf_N