The domain within your query sequence starts at position 869 and ends at position 950; the E-value for the Dimer_Tnp_hAT domain shown below is 1.9e-12.

VDEYFKEKYSELSGGDDPLVYWQRKVSIWPALTQVAIQYLSCPMCSWQSECMFTTNSHFH
PKQIMNMDFDNIEQLIFLKMNL

Dimer_Tnp_hAT

Dimer_Tnp_hAT
PFAM accession number:PF05699
Interpro abstract (IPR008906): This dimerisation domain is found at the C terminus of the transposases of elements belonging to the Activator superfamily (hAT element superfamily). The isolated dimerisation domain forms extremely stable dimers in vitro [(PUBMED:10662858), (PUBMED:11454746)].
GO function:protein dimerization activity (GO:0046983)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dimer_Tnp_hAT