SMART: Pfam domain Diphthami_syn

The domain within your query sequence starts at position 1 and ends at position 242; the E-value for the Diphthami_syn_2 domain shown below is 2e-48.

MRVAALISGGKDSCYNMMQCIAEGHQIVALANLRPDENQVESDELDSYMYQTVGHHAIDL
YAEAMALPLYRRAIRGRSLETGRVYTQCEGDEVEDLYELLKLVKEKEEIEGVSVGAILSD
YQRGRVENVCKRLNLQPLAYLWQRNQEDLLREMIASNIKAIIIKVAALGLDPDKHLGKTL
VEMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIVVDSSEAVMHSADAFAPVAYL
RL

Diphthami_syn_2

PFAM accession number:	PF01902
Interpro abstract (IPR002761):	Diphthamide_syn, diphthamide synthase, catalyses the last amidation step of diphthamide biosynthesis using ammonium and ATP. Diphthamide synthase is evolutionarily conserved in eukaryotes. Diphthamide is a post-translationally modified histidine residue found on archaeal and eukaryotic translation elongation factor 2 (eEF-2) [ (PUBMED:23169644) ]. This domain has a strongly conserved motif SXGXDS at the N terminus [ (PUBMED:12012333) ].

PFAM accession number:

PF01902

Interpro abstract (IPR002761):

Diphthamide_syn, diphthamide synthase, catalyses the last amidation step of diphthamide biosynthesis using ammonium and ATP. Diphthamide synthase is evolutionarily conserved in eukaryotes. Diphthamide is a post-translationally modified histidine residue found on archaeal and eukaryotic translation elongation factor 2 (eEF-2) [ (PUBMED:23169644) ].

This domain has a strongly conserved motif SXGXDS at the N terminus [ (PUBMED:12012333) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Diphthami_syn_2