The domain within your query sequence starts at position 62 and ends at position 276; the E-value for the Diphthamide_syn domain shown below is 1.1e-79.

MPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARALGVDFLVHYGHSCLVP
MDTSVQDFRVLYVFVDIRIDTAHLLDSVRLTFTPGSSLALVSTIQFVSTLQAAAQELKAD
YHISVPQCKPLSPGEILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNIPAYRYDPYG
KVLSREYYDHQRMQATRQEAIAAARSAKSWGLIL

Diphthamide_syn

Diphthamide_syn
PFAM accession number:PF01866
Interpro abstract (IPR016435):

Archaeal and eukaryotic translation elongation factor 2 contain a unique posttranslationally modified histidine residue called diphthamide, the target of the diphtheria toxin. Diphtheria toxin inhibits eukaryotic protein synthesis by ADP-ribosylating diphthamide in EF2 [(PUBMED:15485916)].

Members of this family include DPH1 and DPH2, which are involved in the first step of diphthamide synthesis [(PUBMED:15485916)]. Archaeal DPHs are more similar to eukaryotic DPH1 than to DPH2 [(PUBMED:20559380)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Diphthamide_syn