The domain within your query sequence starts at position 390 and ends at position 631; the E-value for the DnaB_C domain shown below is 6.7e-17.

GVRWSRFPDLNRLLKGHRKGELTVFTGPTGSGKTTFISEYALDLCTQGVNTLWGSFEISN
VRLARVMLTQFAVTRLEEQLDKYEEWADRFEDLPLYFMTFHGQQSIRSVIDTMQHAVYVY
DVCHVVIDNLQFMMGHEQLSSDRIAAQDYIVGAFRKFATDNSCHVTLVIHPRKEDDDKEL
QTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTF
SI

DnaB_C

• PFAM accession number: PF03796
• Interpro abstract (IPR007694):

  The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.

  DnaB helicase C-terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis [ (PUBMED:10049800) ],[ (PUBMED:10645945) ],[ (PUBMED:1569588) ].

• GO process: DNA replication (GO:0006260)
• GO function: DNA helicase activity (GO:0003678), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DnaB_C