The domain within your query sequence starts at position 11 and ends at position 300; the E-value for the Dopey_N domain shown below is 1e-117.

DSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQC
LHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYE
MYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLL
TSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLI
LFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA

Dopey_N

Dopey_N
PFAM accession number:PF04118
Interpro abstract (IPR007249): DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans). DopA homologues are found in mammals. Saccharomyces cerevisiae DOP1 is essential for viability and, affects cellular morphogenesis [(PUBMED:10931277)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dopey_N