The domain within your query sequence starts at position 75 and ends at position 246; the E-value for the Dor1 domain shown below is 1.8e-19.
DKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMED EMDRLATNMAVITNFSARISATLQDRHERITKLAGVHALLRKLQFLFELPSRLTKCVELG AYGQAVRYQGRARAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQRFREGCS
Dor1 |
---|
PFAM accession number: | PF04124 |
---|---|
Interpro abstract (IPR007255): | Conserved oligomeric Golgi complex subunit 8 acts as component of the peripheral membrane COG complex that is involved in intra-Golgi protein trafficking [ (PUBMED:11703943) ]. |
GO component: | Golgi transport complex (GO:0017119) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dor1