The domain within your query sequence starts at position 75 and ends at position 246; the E-value for the Dor1 domain shown below is 1.8e-19.

DKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMED
EMDRLATNMAVITNFSARISATLQDRHERITKLAGVHALLRKLQFLFELPSRLTKCVELG
AYGQAVRYQGRARAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQRFREGCS

Dor1

Dor1
PFAM accession number:PF04124
Interpro abstract (IPR007255): Conserved oligomeric Golgi complex subunit 8 acts as component of the peripheral membrane COG complex that is involved in intra-Golgi protein trafficking [(PUBMED:11703943)].
GO component:Golgi transport complex (GO:0017119)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dor1