SMART: Pfam domain Dpoe2NT

The domain within your query sequence starts at position 2 and ends at position 74; the E-value for the Dpoe2NT domain shown below is 1.9e-32.

APERLRSRTVSAFKLRGLLLRSEATKYLTEALQSVTELELEENLGKIIDAVEKQPLSSNM
IERSVVEAAVQEC

Dpoe2NT

PFAM accession number:	PF12213
Interpro abstract (IPR024639):	This domain is found in the N-terminal of DNA polymerase epsilon subunit B proteins. It contains a single completely conserved phenylalanine residue that may be functionally important. It forms a primarily alpha helical structure in which four helices are arranged in two hairpins with connecting loops containing beta strands which form a short parallel sheet. DNA polymerase epsilon is required in DNA replication for synthesis of the leading strand. The N-terminal domain has close structural relation to AAA+ protein C-terminal domains [ (PUBMED:18676977) ].

PFAM accession number:

PF12213

Interpro abstract (IPR024639):

This domain is found in the N-terminal of DNA polymerase epsilon subunit B proteins. It contains a single completely conserved phenylalanine residue that may be functionally important. It forms a primarily alpha helical structure in which four helices are arranged in two hairpins with connecting loops containing beta strands which form a short parallel sheet.

DNA polymerase epsilon is required in DNA replication for synthesis of the leading strand. The N-terminal domain has close structural relation to AAA+ protein C-terminal domains [ (PUBMED:18676977) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dpoe2NT