The domain within your query sequence starts at position 1 and ends at position 114; the E-value for the Dpy19 domain shown below is 2.5e-50.

FRTECGLYYSYYKQMLQAPTLLQGFHGLIYDNKTESMRTINLLQRMNIYQEVFLSVLYRV
LPIQKYLEPVYFYIYTLFGLQAVYVTALYITSWLLSGTWLSGLLAALWYVTNRG

Dpy19

Dpy19
PFAM accession number:PF10034
Interpro abstract (IPR018732):

This entry represents the Dpy-19 protein from Caenorhabditis elegans and its homologues in other Metazoa, including mammals. In C. elegans, Dpy-19 is required to orient neuroblasts QL and QR correctly on the anterior/posterior (A/P) axis. These neuroblasts are born in the same A/P position, but polarise and migrate left/right asymmetrically, where QL migrates toward the posterior and QR migrates toward the anterior. After their migrations, QL (but not QR) switches on the Hox gene mab-5. Dpy-19 is required along with Unc-40 to express Mab-5 correctly in the Q cell descendants [(PUBMED:11023868)].

A mammalian dpy-19 homologue was found to be expressed in GABAergic neurons [(PUBMED:15944814)]. The mammalian homologue of Mab-5 is the Gsh2 homeobox transcription factor, which plays a crucial role in the development of GABAergic neurons.

Dpy-19 has been shown recently to be a C-mannosyltransferase that mediates C-mannosylation of tryptophan residues [(PUBMED:23562325)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dpy19