The domain within your query sequence starts at position 9 and ends at position 290; the E-value for the DuoxA domain shown below is 3.9e-128.

PFYTGTKPTFPMDTTLAVIITIFLTALVTFIIILPGIRGKTRLFWLLRVVTSLFIGAVIL
AVNFSSEWSVGHVNANTTYKAFSPKWVSVDVGLQIGLGGVNITLTGTPVQQLNETINYNE
AFAWRLGRSYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYNQYRLAGHYASAMLWVAF
LCWLLANVMLSMPVLVYGGHMLLATGLFQLLALFFFSMTTSLISPCPLRLGTAVLHTHHG
PAFWITLATGLLCILLGLVMAVAHRMQPHRLKAFFNQSSEDP

DuoxA

 DuoxA
PFAM accession number:PF10204
Interpro abstract (IPR018469):

DuoxA (Dual oxidase maturation factor) is the essential protein necessary for the final release of DUOX2 (an NADPH:O2 oxidoreductase flavoprotein) from the endoplasmic reticulum. Dual oxidases (DUOX1 and DUOX2) constitute the catalytic core of the hydrogen peroxide generator, which generates H2O2 at the apical membrane of thyroid follicular cells, essential for iodination of thyroglobulin by thyroid peroxidases. DuoxA carries five membrane-integral regions including a reverse signal-anchor with external N terminus (type III) and two N-glycosylation sites [ (PUBMED:16651268) ]. It is conserved from nematodes to humans.

GO process:protein transport (GO:0015031)
GO component:integral component of membrane (GO:0016021), endoplasmic reticulum membrane (GO:0005789)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DuoxA