The domain within your query sequence starts at position 125 and ends at position 378; the E-value for the Dynactin_p62 domain shown below is 8e-20.
DKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSDKYSL GTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEVEPLPEDYYTRPVNLTEVTT LQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQLVAVN YIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNINSTAKVVVPPKE LILAGKDAAAEYDE
Dynactin_p62 |
---|
PFAM accession number: | PF05502 |
---|---|
Interpro abstract (IPR008603): | DCTN4 (also known as dynactin subunit p62) is a subunit of the dynactin that may have a dual role in dynein targeting and in ACTR1A/Arp1 subunit of dynactin pointed-end capping. It could be involved in ACTR1A pointed-end binding and in additional roles in linking dynein and dynactin to the cortical cytoskeleton [ (PUBMED:10607597) ]. It also interacts with the N terminus of P-type ATPase ATP7B [ (PUBMED:16554302) ]. |
GO component: | dynactin complex (GO:0005869) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynactin_p62