The domain within your query sequence starts at position 23 and ends at position 172; the E-value for the Dynactin_p62 domain shown below is 4.8e-24.

PLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPSAEAKLKKNRCANCFDCPGCMHT
LSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMADKSVASGGWQEPENPHTQ
RMNKLIEYYQQLAQKEKVERDRKKLARRRN

Dynactin_p62

Dynactin_p62
PFAM accession number:PF05502
Interpro abstract (IPR008603): DCTN4 (also known as dynactin subunit p62) is a subunit of the dynactin that may have a dual role in dynein targeting and in ACTR1A/Arp1 subunit of dynactin pointed-end capping. It could be involved in ACTR1A pointed-end binding and in additional roles in linking dynein and dynactin to the cortical cytoskeleton [(PUBMED:10607597)]. It also interacts with the N terminus of P-type ATPase ATP7B [(PUBMED:16554302)].
GO component:dynactin complex (GO:0005869)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynactin_p62