The domain within your query sequence starts at position 413 and ends at position 473; the E-value for the Dynamin_M domain shown below is 2.1e-14.

VKKQLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQ
R

Dynamin_M

Dynamin_M
PFAM accession number:PF01031
Interpro abstract (IPR000375): Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles. At the N terminus of dynamin is a GTPase domain (see IPR001401), and at the C terminus is a PH domain (see IPR001849). Between these two domains lies a central region of unknown function, which this entry represents.
GO function:GTP binding (GO:0005525)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynamin_M