The domain within your query sequence starts at position 7 and ends at position 74; the E-value for the Dynein_attach_N domain shown below is 3.3e-32.
INFKALEKELQAALAADEKYKRENAAKLRAVEQRVPSYEEFRGIVLASHLKPLEQKDKMG GKRFVPWN
Dynein_attach_N |
---|
PFAM accession number: | PF15867 |
---|---|
Interpro abstract (IPR031733): | This entry represents the N terminus of a dynein arm attachment factor (known as coiled-coil domain-containing protein 103, CCDC103) which is required for dynein arm assembly and cilia motility [ (PUBMED:22581229) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynein_attach_N