The domain within your query sequence starts at position 7 and ends at position 74; the E-value for the Dynein_attach_N domain shown below is 3.3e-32.

INFKALEKELQAALAADEKYKRENAAKLRAVEQRVPSYEEFRGIVLASHLKPLEQKDKMG
GKRFVPWN

Dynein_attach_N

Dynein_attach_N
PFAM accession number:PF15867
Interpro abstract (IPR031733):

This entry represents the N terminus of a dynein arm attachment factor (known as coiled-coil domain-containing protein 103, CCDC103) which is required for dynein arm assembly and cilia motility [(PUBMED:22581229)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynein_attach_N