The domain within your query sequence starts at position 3605 and ends at position 4304; the E-value for the Dynein_heavy domain shown below is 2.3e-136.

SQQRIRDQLPSWIDQERSWAVATLKISLPSLYQTLCLEDGAFWRTYYHHSMCEQEFPSIL
AKKVSLFQQVLVVQALRPDRLQSAMALFACKALGLKELSPLPLNLKRLYKETLEIEPILI
IISPGADPSQELQELASAERSSECYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLV
VSWLPVLEKELNTLQPKDSFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYE
SWTPEQISKRDNIHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYHVIDR
LFDGTKDVQWEFVHGLLENSIYGGRVDNYFDLRVLQSYLKQFFNSSIIDVLNQRNKKSIF
PYSISLPNSCSILDYRAVIEKLPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSV
TAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQGSPILSFIILEQFNAIR
LVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSRWEGPEDPLQYLRGLV
ARTLAIQNWVEKAEKQVLLADTLDLSELFHPDTFLNALRQETARATGCSVDSLKFVASWK
GRLQEAKLQIKISGLLLEGCSFDGNRLSENQHDSPSVSSVLPCYMGWTPQGSYGPYSPDE
CISLPVYTSAERERVVTNIDVPCGGNQDQWIQCGAALFLK

Dynein_heavy

Dynein_heavy
PFAM accession number:PF03028
Interpro abstract (IPR004273):

Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Dynein is composed of a number of ATP-binding large subunits, intermediate size subunits and small subunits (see IPR001372). This family represents the C-terminal region of dynein heavy chain. The dynein heavy chain also exhibits ATPase activity and microtubule binding ability and acts as a motor for the movement of organelles and vesicles along microtubules.

GO process:microtubule-based movement (GO:0007018)
GO component:dynein complex (GO:0030286)
GO function:microtubule motor activity (GO:0003777)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynein_heavy