The domain within your query sequence starts at position 44 and ends at position 189; the E-value for the Dysbindin domain shown below is 3.6e-61.

GEIVKDVKVPQAALNVSAHETGDMCRTPVAEEEEEVGIPIPAPGFLQVTERRQPLSSVSS
LEVHFDLLDLTELTDMSDQELAEVFADSDDENLATESPAGLHPLSRASCLRSPSWTKTRA
EQNREKQPPSDPERQGTIVDTFLTVE

Dysbindin

 Dysbindin
PFAM accession number:PF04440
Interpro abstract (IPR007531):

Dysbindin is an evolutionary conserved 40kDa coiled-coil-containing protein that binds to alpha- and beta-dystrobrevin in muscle and brain. Dystrophin and alpha-dystrobrevin are co-immunoprecipitated with dysbindin, indicating that dysbindin is DPC-associated in muscle. Dysbindin co-localises with alpha-dystrobrevin at the sarcolemma and is up-regulated in dystrophin-deficient muscle. In the brain, dysbindin is found primarily in axon bundles and especially in certain axon terminals, notably mossy fibre synaptic terminals in the cerebellum and hippocampus. Dysbindin may have implications for the molecular pathology of Duchenne muscular dystrophy and may provide an alternative route for anchoring dystrobrevin and the DPC to the muscle membrane [ (PUBMED:2098102) ]. Genetic variation in the human dysbindin gene is also thought to be associated with Schizophrenia [ (PUBMED:11316798) ].

.
GO component:cytoplasm (GO:0005737)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dysbindin