The domain within your query sequence starts at position 250 and ends at position 318; the E-value for the E1_4HB domain shown below is 2.5e-22.

PKTVRHKPLDIALLQPHVVAQNTQEVQRAHCLHQAFHVLHKFQQLHGRLPKPWDPDDAET
VVELAQDLE

E1_4HB

E1_4HB
PFAM accession number:PF16191
Interpro abstract (IPR032420):

This domain is found in the ubiquitin-activating E1 family enzymes and is C-terminal to the FCCH domain [(PUBMED:18662542)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_4HB