The domain within your query sequence starts at position 66 and ends at position 137; the E-value for the E1_DerP2_DerF2 domain shown below is 1.8e-11.

IPKLPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTE
EKLFCLNFTIIH

E1_DerP2_DerF2

E1_DerP2_DerF2
PFAM accession number:PF02221
Interpro abstract (IPR003172):

The MD-2-related lipid-recognition (ML) domain is implicated in lipid recognition, particularly in the recognition of pathogen related products. It has an immunoglobulin-like beta-sandwich fold similar to that of E-set Ig domains. This domain is present in proteins from plants, animals and fungi, including the following proteins:

  • Epididymal secretory protein E1 (also known as Niemann-Pick C2 protein - Npc2), which is known to bind cholesterol. Niemann-Pick disease type C2 is a fatal hereditary disease characterised by accumulation of low-density lipoprotein-derived cholesterol in lysosomes [ (PUBMED:12591954) ].
  • House-dust mite allergen proteins such as Der f 2 from Dermatophagoides farinae and Der p 2 from Dermatophagoides pteronyssinus [ (PUBMED:15710415) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_DerP2_DerF2