The domain within your query sequence starts at position 66 and ends at position 137; the E-value for the E1_DerP2_DerF2 domain shown below is 1.8e-11.
IPKLPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTE EKLFCLNFTIIH
E1_DerP2_DerF2 |
---|
PFAM accession number: | PF02221 |
---|---|
Interpro abstract (IPR003172): | The MD-2-related lipid-recognition (ML) domain is implicated in lipid recognition, particularly in the recognition of pathogen related products. It has an immunoglobulin-like beta-sandwich fold similar to that of E-set Ig domains. This domain is present in proteins from plants, animals and fungi, including the following proteins:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_DerP2_DerF2