The domain within your query sequence starts at position 178 and ends at position 249; the E-value for the E1_FCCH domain shown below is 1.1e-26.

GFPGIVTLRGDTKRHSFHDGDLVIFSDIEGMVELNSCSPQSVRVQKDGSLEIGDTTTFSR
YLRGGVVTEVKR

E1_FCCH

E1_FCCH
PFAM accession number:PF16190
Interpro abstract (IPR032418):

This domain is found in the ubiquitin-activating E1 (Ub-E1) family enzymes. It is one of the catalytic cysteine half-domains of Ub-E1. The catalytic cysteine half-domains contain the E1 active site cysteine, and are known as FCCH and SCCH, for 'first' and 'second' catalytic cysteine half-domain, respectively [(PUBMED:18662542)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_FCCH