The domain within your query sequence starts at position 110 and ends at position 251; the E-value for the E1_dh domain shown below is 2.1e-14.
EGHPTPRLSFVDVATGSLGQGLGAACGMAYTGKYFDKASYRVFCLMGDGESSEGSVWEAL AFASHYNLDNLVAIFDVNRLGQSGTAPLEHCTAVYEKRCQAFGWNTYVVDGHDVEALCQA FWKAAQVKNKPTALIAKTFKGR
E1_dh |
---|
PFAM accession number: | PF00676 |
---|---|
Interpro abstract (IPR001017): | This entry represents a domain found in a number of dehydrogenases, all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex:
|
GO function: | oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor (GO:0016624) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_dh