The domain within your query sequence starts at position 256 and ends at position 582; the E-value for the E1_dh domain shown below is 1.4e-95.

ARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRL
NVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPS
HLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTH
GTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRN
TFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEY
EEEISKYDKICEEAFTRSKDEKILHIK

E1_dh

E1_dh
PFAM accession number:PF00676
Interpro abstract (IPR001017): This entry represents a domain found in a number of dehydrogenases, all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex:
  • pyruvate dehydrogenase (EC 1.2.4.1), a component of the multienzyme pyruvate dehydrogenase complex
  • 2-oxoglutarate dehydrogenase (EC 1.2.4.2), a component of the multienzyme 2-oxoglutarate dehydrogenase, which contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3)
  • 2-oxoisovalerate dehydrogenase (EC 1.2.4.4), a component of the multienzyme branched-chain alpha-keto dehydrogenase complex.
GO process:metabolic process (GO:0008152)
GO function:oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor (GO:0016624)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_dh