The domain within your query sequence starts at position 100 and ends at position 196; the E-value for the E2F_CC-MB domain shown below is 2.8e-36.

LKAEIEELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHEDICRCFAGDTLLAIRA
PSGTSLEVPIPEGLNGQKKYQIHLKSMSGPIEVLLVN

E2F_CC-MB

E2F_CC-MB
PFAM accession number:PF16421
Interpro abstract (IPR032198):

This is the coiled coil (CC) - marked box (MB) domain of E2F transcription factors. This domain forms a heterodimer with the corresponding domain of the DP transcription factor, the heterodimer binds the C terminus of retinoblastoma protein [(PUBMED:16360038)].

GO function:protein dimerization activity (GO:0046983)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry E2F_CC-MB