The domain within your query sequence starts at position 1205 and ends at position 1301; the E-value for the E3_UbLigase_R4 domain shown below is 4.5e-60.

MPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYK
KVWCATNEGEPMRIVYRMRGLLGDATEEFIESLDSTT

E3_UbLigase_R4

E3_UbLigase_R4
PFAM accession number:PF13764
Interpro abstract (IPR025704):

This is a family of E3 ubiquitin ligase enzymes. Members of this family also include auxin transport protein BIG and protein purity of essence. In humans and mouse, E3 ubiquitin-protein ligase is a component of the N-end rule pathway. It recognises and binds to proteins bearing specific N-terminal residues that are destabilising according to the N-end rule, leading to their ubiquitination and subsequent degradation. Together with clathrin, it forms meshwork structures involved in membrane morphogenesis and cytoskeletal organisation. It also regulates integrin-mediated signaling and may play a role in activation of FAK in response to cell-matrix interactions [(PUBMED:16214886), (PUBMED:16055722)].

Auxin transport protein, as suggested by its name, is required for auxin efflux and polar auxin transport (PAT) influencing auxin-mediated developmental responses (e.g. cell elongation, apical dominance, lateral root production, inflorescence architecture, general growth and development) [(PUBMED:11485992)]. Auxin transport protein is also involved in the elongation of the pedicels and stem internodes through auxin action, the expression/modulation of light-regulated genes, repression of CAB1 and CAB3 genes in etiolated seedlings, etc [(PUBMED:8314087), (PUBMED:9165751), (PUBMED:9390435), (PUBMED:12834402), (PUBMED:15634200), (PUBMED:15681664), (PUBMED:17652113), (PUBMED:19176721)].

Protein purity of essence, found in Drosophila melanogaster, has a role in growth of the perineurial glial layer of the larval peripheral nerve and it may have a role in male fertility and eye development or function [(PUBMED:11517334), (PUBMED:9813038), (PUBMED:8244010)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry E3_UbLigase_R4