The domain within your query sequence starts at position 2636 and ends at position 2808; the E-value for the EB1_binding domain shown below is 2.9e-90.
RSGRSPTGNTPPVIDSVSEKGSSSIKDSKDTHGKQSVGSGSPVQTVGLETRLNSFVQVEA PEQKGTEAKPGQSNPVSIAETAETCIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSP RKSSADSTSARPSQIPTPVSTNTKKRDSKTDSTESSGAQSPKRHSGSYLVTSV
EB1_binding |
---|
PFAM accession number: | PF05937 |
---|---|
Interpro abstract (IPR009232): | This region at the C terminus of the APC proteins binds the microtubule-associating protein EB-1 [ (PUBMED:11514192) ]. At the C terminus of the alignment is also a PDZ-binding domain. A short motif in the middle of the region appears to be found in the APC2 proteins (e.g. O95996 ). |
GO process: | Wnt signaling pathway (GO:0016055) |
GO function: | beta-catenin binding (GO:0008013) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EB1_binding