The domain within your query sequence starts at position 12 and ends at position 197; the E-value for the EBP domain shown below is 1.2e-66.

GSSLLLCSALLAVGCALGLRLGRGRSAVERWVLAWLCYDSLVHFVLEGAFVYLSIVGNVA
DSQGLIASLWKEYGKADTRWLYSDPTVVSLEILTVVLDGLLALVLIYAIVKEKYYRHFVQ
IVLCVCELYGCWMTFFPEWLVGSPSLNTSSWLYLWVYLVFFNGLWVLIPGLLLWQSWVEL
KKRDSQ

EBP

EBP
PFAM accession number:PF05241
Interpro abstract (IPR007905):

Emopamil binding protein (EBP) is a nonglycosylated type I integral membrane protein of endoplasmic reticulum and shows high level expression in epithelial tissues. The EBP protein has emopamil binding domains, including the sterol acceptor site and the catalytic centre, which show Delta8-Delta7 sterol isomerase activity. Human sterol isomerase, a homologue of mouse EBP, is suggested not only to play a role in cholesterol biosynthesis, but also to affect lipoprotein internalisation. In humans, mutations of EBP are known to cause the genetic disorder of X-linked dominant chondrodysplasia punctata (CDPX2). This syndrome of humans is lethal in most males, and affected females display asymmetric hyperkeratotic skin and skeletal abnormalities [(PUBMED:11471053)].

GO process:sterol metabolic process (GO:0016125)
GO component:integral component of membrane (GO:0016021)
GO function:cholestenol delta-isomerase activity (GO:0047750)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EBP