The domain within your query sequence starts at position 261 and ends at position 337; the E-value for the EBP50_C domain shown below is 2.3e-22.

SPAQLNGGSVCSSRSDLPGSEKDNEDGSTWKRDPFQESGLHLSPTAAEAKEKARATRVNK
RAPQMDWNRKREIFSNF

EBP50_C

EBP50_C
PFAM accession number:PF09007
Interpro abstract (IPR015098):

This C-terminal domain allows interaction of EBP50 with FERM (four-point one ERM) domains, resulting in the activation of Ezrin-radixin-moesin (ERM), with subsequent cytoskeletal modulation and cellular growth control [(PUBMED:15020681)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EBP50_C