The domain within your query sequence starts at position 59 and ends at position 142; the E-value for the ECH_1 domain shown below is 1.3e-15.
EENRGIVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADL KERAKMHSSEVGPFVSKIRSVIND
ECH_1 |
---|
PFAM accession number: | PF00378 |
---|---|
Interpro abstract (IPR001753): | This family contains a diverse set of enzymes including: enoyl-CoA hydratase, 1,4-dihydroxy-2-naphthoyl-CoA synthase (napthoate synthase), carnitinyl-CoA dehydratase (carnitine racemase), 3-hydroxybutyryl-CoA dehydratase and enoyl-CoA delta isomerase (dodecanoyl-CoA delta-isomerase). |
GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECH_1