The domain within your query sequence starts at position 61 and ends at position 321; the E-value for the ECH_1 domain shown below is 7.2e-50.

SAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLM
DMASELMQPSGDDAARIAWYLRDLISKYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLVSA
CDIRYCTQDAFFQIKEVDMGLAADVGTLQRLPKVIGNQSLVNELTFSARKMMADEALDSG
LVSRVFQDKDAMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSM
LQTQDIIKSVQAAMEKRDTKS

ECH_1

ECH_1
PFAM accession number:PF00378
Interpro abstract (IPR001753):

This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase.

GO process:metabolic process (GO:0008152)
GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECH_1