The domain within your query sequence starts at position 56 and ends at position 294; the E-value for the ECH_2 domain shown below is 1.5e-29.

IRNIVLSNPRRRNALSLAMLKSLRSDILHEAESEDLKVIIISAEGPVFSSGHDLKELTDA
QGRDYHAEVFQTCSEVMMLIRNHPVPILAMVNGLATAAGCQLVASCDIAVASDKSSFATP
GVNVGLFCSTPAVALGRAVPRKVALEMLFTGEPISAQEALRHGLISKVVPEEQLEAETMR
IAKKISSLSRSVVALGKATFYKQLPQDLRTAYFLASQAMVDNLALQDGQEGIEAFIQKR

ECH_2

ECH_2
PFAM accession number:PF16113
Interpro abstract (IPR032259):

The enoyl-CoA hydratase/isomerase family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. This entry represents a subset of the enoyl-CoA hydratase/isomerase family. Proteins in this entry includes 3-hydroxyisobutyryl-CoA hydrolases (HIBYL-CoA-H) from eukaryotes and their homologues from bacteria.

Human HIBYL-CoA-H is a mitochondrial enzyme that catalyses the fifth step in the valine catabolic pathway in eukaryotes, namely the conversion of 3-hydroxyisobutyryl-CoA to free 3-hydroxyisobutyrate [(PUBMED:8824301), (PUBMED:21104317)]. It also hydrolyses 3-hydroxypropionyl-CoA, giving it a dual role in a secondary pathway of propionate metabolism [(PUBMED:26163321)]. Deficiency of this enzyme is associated with Leigh-like disease [(PUBMED:25125611), (PUBMED:24299452)].

GO function:3-hydroxyisobutyryl-CoA hydrolase activity (GO:0003860)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECH_2