The domain within your query sequence starts at position 1 and ends at position 266; the E-value for the ECM1 domain shown below is 4.4e-132.
MGTVSRAALILACLALASAASEGAFKASDQREMTPERLFQHLHEGREGPPHPTVCLTTAC SVVQPPSSPEDIPVYEEDWPTFLNPNVDKAGPAVPQEAIPLQKEQPPPQVHIEQKEIDPP AQPQEEIVQKEVKPHTLAGQLPPEPRTWNPARHCQQGRRGVWGHRLDGFPPGRPSPDNLK QICLPERQHVIYGPWNLPQTGYSHLSRQGETLNVLETGYSRCCRCRSDTNRLDCLKLVWE DAMTQFCEAEFSVKTRPHLCCRLRGE
ECM1 |
---|
PFAM accession number: | PF05782 |
---|---|
Interpro abstract (IPR008605): | This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis [ (PUBMED:11165938) (PUBMED:11292659) ]. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalised thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness [ (PUBMED:11929856) ]. |
GO process: | signal transduction (GO:0007165) |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECM1