The domain within your query sequence starts at position 1 and ends at position 559; the E-value for the ECM1 domain shown below is < 1e-12.

MGTVSRAALILACLALASAASEGAFKASDQREMTPERLFQHLHEVGYAAPPSPPQTRRLR
VDHSVTSLHDPPLFEEQREVQPPSSPEDIPVYEEDWPTFLNPNVDKAGPAVPQEAIPLQK
EQPPPQVHIEQKEIDPPAQPQEEIVQKEVKPHTLAGQLPPEPRTWNPARHCQQGRRGVWG
HRLDGFPPGRPSPDNLKQICLPERQHVIYGPWNLPQTGYSHLSRQGETLNVLETGYSRCC
RCRSDTNRLDCLKLVWEDAMTQFCEAEFSVKTRPHLCCRLRGEERFSCFQKEAPRPDYLL
RPCPVHQNGMSSGPQLPFPPGLPTPDNVKNICLLRRFRAVPRNLPATDAIQRQLQALTRL
ETEFQRCCRQGHNHTCTWKAWEGTLDGYCERELAIKTHPHSCCHYPPSPARDECFAHLAP
YPNYDRDILTLDLSRVTPNLMGQLCGSGRVLSKHKQIPGLIQNMTIRCCELPYPEQACCG
EEEKLAFIENLCGPRRNSWKDPALCCDLSPEDKQINCFNTNYLRNVALVAGDTGNATGLG
EQGPTRGTDANPAPGSKEE

ECM1

ECM1
PFAM accession number:PF05782
Interpro abstract (IPR008605): This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis [(PUBMED:11165938), (PUBMED:11292659)]. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalised thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness [(PUBMED:11929856)].
GO process:signal transduction (GO:0007165)
GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECM1