The domain within your query sequence starts at position 39 and ends at position 267; the E-value for the ECSIT domain shown below is 5e-106.

RGLHCSAATHKDEPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGA
HNVRKRGHVDFIYLALRKMPEFGVERDLSVYNLLLDVFPKEVFRPRNVIQRIFVHYPRQQ
ECGVAVLEQMERHGVMPSAETEFLLIQIFGRKSYPMLKFLRMKLWFTRFKNINPYPVPRD
LPQDPLDLAKLGLRHMEPDLSAKVTVYQMSLPSDSTGMEDPTQPHIVGI

ECSIT

ECSIT
PFAM accession number:PF06239
Interpro abstract (IPR010418):

Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses. ECSIT plays an important role in signalling to NF-kappaB, functioning as the intermediate in the signalling pathways between TRAF-6 and MEKK-1 [(PUBMED:10465784)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECSIT