The domain within your query sequence starts at position 197 and ends at position 246; the E-value for the EF-hand_10 domain shown below is 1.8e-27.

KMSFKEIKSLLRMVNVDMNDMYAYRLFKECDHSNNERLEGAEIEAFLRRL

EF-hand_10

EF-hand_10
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF-hand_10