The domain within your query sequence starts at position 410 and ends at position 528; the E-value for the EF-hand_2 domain shown below is 9.5e-36.

TELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDLVTLTTALEIFNEHDLQASEHVMDVV
EVIHCLTALYERLEEERGILVNVPLCVDMSLNWLLNVFDSGRSGKMRALSFKTGIACLC

EF-hand_2

EF-hand_2
PFAM accession number:PF09068
Interpro abstract (IPR015153):

Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions. The main function of this domain is the provision of specificity in beta-dystroglycan recognition, though in dystrophin it serves an additional role: stabilisation of the WW domain (IPR001202), enhancing dystroglycan binding [(PUBMED:10932245)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF-hand_2