The domain within your query sequence starts at position 1305 and ends at position 1369; the E-value for the EF-hand_like domain shown below is 5.9e-11.
VGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASK NDESR
EF-hand_like |
---|
PFAM accession number: | PF09279 |
---|---|
Interpro abstract (IPR015359): | This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C. It adopts a structure consisting of a core of four alpha helices, in an EF like fold, and is required for functioning of the enzyme [ (PUBMED:8784353) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF-hand_like