The domain within your query sequence starts at position 3 and ends at position 110; the E-value for the EFTUD2 domain shown below is 1.1e-42.

TDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDEDEDEDDVGEHEDDHPGMEVVLHED
KKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLP

EFTUD2

EFTUD2
PFAM accession number:PF16004
Interpro abstract (IPR031950): This entry represents the N-terminal domain of U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116kDa). It is also found in Snu114p, a 114 kDa protein homologous to U5-116kDa that has been identified in Saccharomyces cerevisiae [(PUBMED:9233818)]. Both proteins seem to have a role in pre-mRNA splicing process.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EFTUD2