The domain within your query sequence starts at position 341 and ends at position 412; the E-value for the EF_assoc_1 domain shown below is 1.8e-25.
WGPELLHTVPTQAGCLPLHGYLCQWTLMTYLDVQQCLAHLGYLGYPTLCEQDSQAQAITV TREKKLDQEKGQ
EF_assoc_1 |
![]() |
---|
PFAM accession number: | PF08355 |
---|---|
Interpro abstract (IPR013566): | This region typically appears on the C terminus of EF hands in GTP-binding proteins such as Arht/Rhot (may be involved in mitochondrial homeostasis and apoptosis[ (PUBMED:15218247) ]). The EF hand associated region is found in yeast, vertebrates and plants. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF_assoc_1