The domain within your query sequence starts at position 27 and ends at position 59; the E-value for the EHD_N domain shown below is 3e-20.

GLRSLYQRKVLPLEEAYRFHEFHSPALEDADFE

EHD_N

• PFAM accession number: PF16880
• Interpro abstract (IPR031692):

  This is a short domain that lies at the very N terminus of many dynamins and EF-hand domain-containing proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EHD_N